Everything below concerns creatine. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2026-08-01. Numbers and descriptions here follow the published literature rather than marketing material.
Identity and purity are commonly assessed by high-performance liquid chromatography, often with ultraviolet detection, and by spectroscopic techniques such as infrared or nuclear magnetic resonance. These methods can distinguish creatine from creatinine and detect related impurities. Moisture content may be measured by Karl Fischer titration or loss on drying. Particle size, bulk density, and heavy metal limits are additional quality parameters. Not every product is tested by every method, so specifications depend on the intended use and regulatory framework.
Solid creatine monohydrate is generally stable when kept dry and protected from extremes of heat and humidity. In the presence of moisture, it can gradually convert to creatinine, a cyclic dehydration product that has little value for phosphocreatine synthesis. Elevated temperatures and acidic conditions accelerate this conversion in solution. Because the reaction is slow in cool, dry storage, typical shelf lives are measured in years rather than weeks. Packaging that limits moisture and oxygen exposure helps maintain purity.
The term creatine monohydrate is often shortened to creatine in casual usage, though other creatine forms exist, including citrate, nitrate, and hydrochloride salts. These alternative forms differ in solubility, pH behavior, and the amount of creatine delivered per unit mass. Regulatory categories vary by country: some jurisdictions treat it as a food ingredient, while others place it under supplement or drug frameworks depending on claims and presentation. Standard reference texts list it as a naturally occurring nitrogenous organic acid rather than a vitamin or mineral.
Creatine monohydrate is a crystalline organic compound formed from creatine and water in a one-to-one ratio. It belongs to the guanidino family and contains a methylated guanidine group attached to an acetate-like chain. The solid is commonly described as a white, odorless powder with a mildly bitter taste. Its molecular formula is C4H11N3O3·H2O, and the hydrated form is the most widely traded grade. The compound occurs naturally in vertebrate muscle and brain tissue, where it participates in rapid energy buffering.
| Property | Value | Notes |
|---|---|---|
| Typical storage temperature | 15–25 °C | Cool, dry, sealed conditions slow conversion to creatinine. |
| Moisture sensitivity | Moderate | Absorbs water from humid air, which can cause caking. |
| Primary purity method | HPLC-UV | Separates creatine from creatinine and related impurities. |
| Moisture method | Karl Fischer titration | Measures water content; loss on drying is an alternative. |
| Degradation product | Creatinine | Forms by dehydration, especially in solution or humid heat. |
Storage recommendations generally emphasize a cool, dry place away from direct sunlight and strong oxidizers. Sealed containers limit humidity exchange, which helps prevent clumping and gradual conversion to creatinine. Long-term stability studies usually monitor appearance, moisture, and purity at intervals under defined temperature and humidity conditions. Accelerated tests at elevated temperature can reveal degradation pathways, but they do not perfectly predict room-temperature shelf life. Questions remain about how much creatinine formation is acceptable in different product categories and how packaging choices affect that rate over time.
Commercial creatine monohydrate is typically manufactured through chemical synthesis, often starting from sarcosine and cyanamide. The resulting material is crystallized, washed, and dried to a specified hydrate content. Finished lots are tested for identity, purity, moisture, and heavy metals before release. Because the compound can cyclize to creatinine under heat or prolonged storage in solution, manufacturers control temperature and humidity during processing. The solid itself is relatively stable when kept dry and sealed, but moisture uptake can cause caking and complicate accurate assay.
Analytical laboratories commonly identify creatine monohydrate by high-performance liquid chromatography with ultraviolet detection, often after dissolving the sample in water or dilute acid. Ion-exchange or reversed-phase columns separate creatine from creatinine and related guanidino compounds. Nitrogen content can be checked by Kjeldahl or combustion methods, while moisture is measured by Karl Fischer titration or loss on drying. These techniques give complementary views: chromatographic purity addresses related substances, whereas moisture and elemental data confirm hydrate stoichiometry. No single test defines quality by itself; a combination is used in specifications.
Analytical laboratories commonly use high-performance liquid chromatography to separate creatine from creatinine and related impurities. Ion chromatography, nuclear magnetic resonance, and titration assays can also quantify the compound. Water content is measured by Karl Fischer titration or loss on drying, because the monohydrate has a defined theoretical water fraction. Particle size, bulk density, and flowability are physical properties that affect blending and capsule filling. These measurements support quality control and help verify that a lot matches its specification.
Regulatory status varies by country. In the United States, creatine monohydrate is sold as a dietary supplement ingredient, while in the European Union it is placed on the market as a food supplement component. Some jurisdictions have established purity monographs or permitted health claims, while others treat it as a novel food or require notification. Product labels may state the amount of creatine monohydrate or the equivalent creatine content, and the two figures can differ. Independent testing programs sometimes check identity, potency, and contaminant limits.
Creatine monohydrate is stable under dry, cool conditions but can degrade when exposed to moisture and heat. In solution, it undergoes hydrolysis to creatinine, a cyclic derivative with little role in phosphagen energy transfer. The rate of conversion increases with temperature, storage time, and acidic or alkaline pH. Solid material kept in a sealed container at room temperature generally retains its composition for extended periods. Moisture uptake is a primary concern because it can accelerate breakdown and caking.
Creatine monohydrate is a crystalline compound formed from creatine and one molecule of water. Creatine itself is a nitrogen-containing organic acid that occurs in vertebrate muscle and other tissues. The monohydrate designation refers to the water included in the crystal lattice, not to water added during manufacturing. Its chemical formula is commonly written as C4H9N3O2·H2O. The solid is typically a white, odorless powder with low solubility in water at room temperature. It is one of several creatine forms described in scientific and commercial literature.
The compound was identified in the nineteenth century after chemists isolated a nitrogenous substance from meat extracts. Later work established its role in muscle energy metabolism and its conversion to phosphocreatine. Chemical synthesis of creatine followed, and industrial production made the monohydrate widely available as a purified powder. Interest expanded in the late twentieth century when researchers began studying creatine supplementation and muscle physiology. Historical accounts sometimes differ on exact dates and attributions, but the broad sequence from tissue extracts to synthetic production is well documented.
Laboratory analysis of creatine monohydrate typically uses high-performance liquid chromatography to separate creatine from creatinine and other impurities. Detection may be ultraviolet, refractive index, or mass spectrometric, depending on the laboratory's equipment and the required sensitivity. Nuclear magnetic resonance spectroscopy can quantify the main component and identify related substances. Water content is measured by Karl Fischer titration, which is important because the monohydrate has a defined theoretical hydration level. Heavy metals, residual solvents, and microbial limits are also checked in quality control programs.
Commercial creatine monohydrate is produced mainly by chemical synthesis rather than extraction from animal tissue. Suppliers provide a certificate of analysis listing assay, water content, and impurity limits, and some products undergo third-party testing. Verification of identity can use infrared or Raman spectroscopy alongside chromatographic methods. Storage recommendations generally call for a cool, dry place and a tightly closed container to limit moisture uptake. Open questions include how packaging, flavoring agents, and long-term storage affect the stability of finished products.
Dry creatine monohydrate is generally stable when kept sealed and protected from heat and moisture. In solution, however, creatine undergoes a slow cyclization to creatinine, a related compound with no role in phosphocreatine storage. The rate of this conversion increases with temperature and is influenced by pH. Because creatinine is a common impurity in liquid or poorly stored products, analytical testing often measures both compounds. The crystalline monohydrate is less prone to degradation than aqueous preparations, though caking can occur if moisture enters the container.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
After replication of the desired region, the RNA primer is removed by DNA polymerase I via the process of nick translation. The removal of the RNA primer allows DNA ligase to ligate the DNA-DNA nick between the new fragment and the previous strand. DNA polymerase I & III, along with many other enzymes are all required for the high fidelity, high-processivity of DNA replication. Beta clamp DNA polymerase DNA replication Overview at Oregon State University DNA+Polymerase+III at the U.S. National Library of Medicine Medical Subject Headings (MeSH) Clamping down on pathogenic bacteria[link removed] – how to shut down a key DNA polymerase complex
Aminosalicylic acid was introduced to clinical use in 1944. It was the second antibiotic found to be effective in the treatment of tuberculosis, after streptomycin. PAS formed part of the standard treatment for tuberculosis prior to the introduction of rifampicin and pyrazinamide. Its potency is less than that of the current five first-line drugs (isoniazid, rifampicin, ethambutol, pyrazinamide, and streptomycin) for treating tuberculosis and its cost is higher, but it is still useful in the treatment of multidrug-resistant tuberculosis. PAS is always used in combination with other anti-TB drugs. 4-Aminosalicylic acid has also been used in the treatment of inflammatory bowel disease (ulcerative colitis and Crohn's disease), but has been superseded by other drugs such as sulfasalazine and mesalazine. 4-Aminosalicylic acid has been investigated for the use in manganese chelation therapy, and a 17-year follow-up study shows that it might be superior to other chelation protocols such as EDTA.
Atypical sphingolipids' lack of C1-OH (hydroxyl group) of sphinganine its the cause they accumulate in the cytoplasm and cannot be degraded. These headless sphingolipids are not able to be phosphorylated and they can neither converted into complex lipids as sphingomyelins and glycosphingolipids (galactosylceramides, gangliosides, cerebrosides ...). Instead, they have toxic effects to the cell. Despite previous opinions that 1-deoxySLs are dead-end metabolites, new researches prove the opposite. Its concentrations decrease over time because atypical sphingolipids convert into downstream products, which normally are polyunsaturated and polyhydroxylated. The main reason for this transformation is detoxification. The enzymes involved in this process produce the change within several days, making it a slow conversion. This take places in two stages:
1-Heneicosanol is the C21 member of the series of linear, saturated primary alcohols derived formally from heneicosane by substitution of a terminal hydrogen atom with a hydroxyl group. It is classified as a long-chain fatty alcohol. Commercial material is typically obtained as a white powder or low-melting wax with a reported melting range of about 68–71 °C. A safety data compilation and estimation methods indicate a high normal boiling point of around 366 °C at 760 mmHg, consistent with its long carbon chain. The compound has very low solubility in water and a high octanol/water partition coefficient (log P), reflecting its pronounced hydrophobic character.
Sources: en.wikipedia.org
Beta-lactamase Dihydrofolate reductase (DHFR) Focal adhesion kinase (FAK) Gal4, a yeast transcription factor (as in the classical yeast two-hybrid system) GFP (split-GFP), e.g. EGFP (enhanced green fluorescent protein) Horseradish peroxidase Infrared fluorescent protein IFP1.4, an engineered chromophore-binding domain (CBD) of a bacteriophytochrome from Deinococcus radiodurans LacZ (beta-galactosidase) Luciferase, including ReBiL (recombinase enhanced bimolecular luciferase) and Gaussia princeps luciferase. Commercial products using luciferase include NanoLuc and NanoBIT. A modification has also been developed for lipid droplet-associated interactions. FAST (splitFAST) TEV (Tobacco etch virus protease) Ubiquitin The methods mentioned above have been applied to whole genomes, e.g. yeast or syphilis bacteria.
Risk factors for kidney disease include diabetes, high blood pressure, family history, older age, ethnic group and smoking. For most patients, a GFR over 60 (mL/min)/(1.73 m2) is adequate. But significant decline of the GFR from a previous test result can be an early indicator of kidney disease requiring medical intervention. The sooner kidney dysfunction is diagnosed and treated the greater chance of preserving remaining nephrons, and preventing the need for dialysis. The severity of chronic kidney disease (CKD) is described by six stages; the most severe three are defined by the MDRD-eGFR value, and first three also depend on whether there is other evidence of kidney disease (e.g., proteinuria):
The Analytical Information Markup Language (AnIML) is an open ASTM XML standard for storing and sharing analytical chemistry and biological data. A main reason of using AnIML is that FAIR data (Findable, Accessible, Interoperable and Reusable) standards are automatically implemented. As AnIML's structure is human-readable, Accessibility is given. Interoperability, Reusability and Findability are secured by the AnIML Core and AnIML Technique Definitions. AnIML has been continuously worked on starting from 2003 up to 2020. The last AnIML Core Version update happened in 2010. So far, no standardisation document nor public example files have been published. The standard exists only in pre-release form. AnIML is a XML standard which consists of two logical layers:
Amino acid N-carboxyanhydrides, also called Leuchs' anhydrides, are a family of heterocyclic organic compounds derived from amino acids. They are white, moisture-reactive solids. They have been evaluated for applications the field of biomaterials. NCAs are typically prepared by phosgenation of amino acids: They were first synthesized by Hermann Leuchs by heating an N-ethoxycarbonyl or N-methoxycarbonyl amino acid chloride in a vacuum at 50-70 °C: A moisture-tolerant route to unprotected NCAs employs epoxides as scavengers of hydrogen chloride. This synthesis of NCAs is sometimes called the Leuchs method. The relatively high temperatures necessary for this cyclization results in the decomposition of several NCAs. Of several improvements, one notable procedure involves treating an unprotected amino acid with phosgene or its trimer. NCAs are prone to hydrolysis to the parent amino acid: RCHNHC(O)OC(O) + H2O → H2NCH(R)CO2H + CO2 Some derivatives however tolerate water briefly. NCAs convert to homopolypeptides ( [N(H)CH(R)CO)]n) through ring-opening polymerization:
Across several benchmarks, AlphaFold3 has demonstrated, on average, superior performance to conventional search-based docking algorithms in predicting small-molecule–protein binding modes. AlphaFold 3 version can predict structures of protein complexes with a very limited set of selected cofactors and co- and post-translational modifications. Between 50% and 70% of the structures of the human proteome are incomplete without covalently-attached glycans. Studies have shown that although AlphaFold3 can jointly model protein–ligand co-folding, its accuracy drops markedly on test cases with low similarity to its training data—an area of particular importance for drug discovery. Other work has found that AlphaFold is insensitive to adversarial decoys generated by altering the physicochemical properties of binding pockets, suggesting potential reliance on training-set memorization rather than genuine chemical awareness.
Sources: en.wikipedia.org
SNX8 is thought to be an adaptor protein involved in the endosome-to-Golgi transport pathway, participating in endocytosis and endosomal sorting and signaling. It downregulates retrograde transport of intracellular proteins from the early endosome compartment to the trans-Golgi network in a retromer-mediated manner. SNX8 is therefore localized in early endosomes, as its colocalization with components of the retromer such as SNX1, SNX2, Vps26 and Vps35 has been demonstrated by some studies (and also with EEA1). Furthermore, the dynamics of endosomal structures with SNX8-enriched membrane domains are regulated by the opposite motor proteins dynein-1 containing LIC1 and kinesin-1, both of which allow SNX8-mediated cargo movement through the cytosol by exerting forces on these structures. The biological functions of SNX8 that have been studied, all of which involve its role in intracellular endosomal transport, are explained in more detail in the following sections.
Vaginal gels are forms of medication that are water-based. They are applied using a plastic applicator to distribute the gel throughout the length of the vaginal canal. These gels tend to have release kinetics that are fast acting, which makes them useful for treatment of irritations. Antibiotics are often distributed in the form of a gel for treatment of common infections, including sexually transmitted infections (STIs). The gels also have the benefit of being lubricating, which grants additional relief to symptoms of dryness and itching that is common with vaginal infections. Gels that are in the form of liposomal structure have been shown to retain substances for extensive periods of time, making them useful for slow release of drugs administered through the cervical drug delivery route
BioLegend was founded by CEO, Gene Lay, D.V.M., who was also the co-founder of PharMingen. In 2011, BioLegend co-developed and introduced Brilliant Violet(TM)-conjugated antibodies, using a novel fluorophore based on Nobel Prize-winning chemistry developed by Sirigen. In 2018, BioLegend introduced TotalSeq™ antibody-oligonucleotide conjugates for use in single cell proteogenomics analysis. BioLegend continued expansion and moved into a new 8-acre campus at BioLegend Way in 2019 with state of the art facilities designed to accommodate up to 1000 employees.
Nucleic acid (DNA and RNA) strands with corresponding sequences stick together in pairwise chains. But each node of the chain is not very sticky, so the double-stranded chain is continuously coming partway unzipped and re-zipping itself under the influence of ambient vibrations (referred to as thermal noise or Brownian motion). Longer pairings are more stable. Nucleic acid tests use a "probe" which is a long strand with a short strand stuck to it. The long primer strand has a corresponding (complementary) sequence to a "target" strand from the disease organism being detected. The disease strand sticks tightly to the exposed part of the long primer strand (called the "toehold"), and then little by little, displaces the short "protector" strand from the probe. In the end, the short protector strand is not bound to anything, and the unbound short primer is detectable. The rest of this section gives some history of the research needed to fine-tune this process into a useful test.
Sources: en.wikipedia.org
Solid product can remain within specification for years when stored dry and sealed, but expiration dates reflect manufacturer testing and regulatory conventions. Moisture and heat increase conversion to creatinine, so storage conditions matter more than the printed date alone. Degradation is gradual and can be monitored by purity testing.
Purity is typically evaluated by chromatographic separation with ultraviolet detection, sometimes supported by spectroscopic identity tests. Moisture and creatinine content are common quality parameters. Results depend on the analytical method, sample preparation, and specification limits.
Clumping occurs when powder absorbs moisture, causing particles to stick together. Humidity, temperature changes, and repeated container opening promote this effect. Clumps do not necessarily indicate chemical degradation, but they can affect weighing and mixing.
In common usage, yes, but technically creatine monohydrate is one specific hydrated salt form. Other creatine forms exist and differ in composition and properties. The monohydrate is the most studied and most widely available grade.