This is a working overview of phosphocreatine, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2026-02-02 and is reviewed periodically as new material appears.
Identity and purity are assessed with several complementary methods. High-performance liquid chromatography can separate creatine from creatinine and related impurities, often with ultraviolet detection. Nuclear magnetic resonance and infrared spectroscopy provide structural confirmation, while Karl Fischer titration measures water content. Elemental analysis and mass spectrometry may be used for additional confirmation, especially in research or forensic settings. No single method captures every quality attribute, so laboratories typically combine results and compare them against a specification.
Creatine monohydrate is sold as a dietary ingredient in some countries and as a food supplement in others. Regulatory frameworks vary, so purity limits, labeling rules, and permitted claims are not globally uniform. In the United States, it falls under dietary supplement rules, whereas the European Union treats it as a food supplement ingredient. Pharmacopeial monographs, where they exist, can provide public quality standards, but not every product is required to meet them. Questions about long-term effects and patterns of use remain areas of active study rather than settled regulatory findings.
Solid creatine monohydrate is generally stable when kept cool and dry, but it can hydrolyze to creatinine over time. Moisture, heat, and acidic conditions accelerate this conversion, which reduces assay values and changes the material's properties. Creatinine is a cyclic dehydration product that is also a normal human metabolite, so its presence in a sample is not necessarily a health concern by itself. In quality testing, creatinine is monitored as a marker of degradation and purity.
In the body, creatine is obtained from dietary meat and fish and is also synthesized from arginine, glycine, and methionine. Muscle stores creatine and phosphocreatine, which participate in the rapid regeneration of adenosine triphosphate during short, intense activity. The monohydrate form is used in research because it is chemically defined, stable as a dry solid, and relatively inexpensive to produce. Questions remain about whether other creatine forms offer meaningful advantages in absorption or tissue retention, and findings vary across studies and populations.
Creatine monohydrate is a crystalline compound formed from creatine and one molecule of water. Creatine itself is a nitrogen-containing organic acid that occurs in vertebrate muscle and other tissues. The monohydrate designation refers to the water included in the crystal lattice, not to water added during manufacturing. Its chemical formula is commonly written as C4H9N3O2·H2O. The solid is typically a white, odorless powder with low solubility in water at room temperature. It is one of several creatine forms described in scientific and commercial literature.
The compound was identified in the nineteenth century after chemists isolated a nitrogenous substance from meat extracts. Later work established its role in muscle energy metabolism and its conversion to phosphocreatine. Chemical synthesis of creatine followed, and industrial production made the monohydrate widely available as a purified powder. Interest expanded in the late twentieth century when researchers began studying creatine supplementation and muscle physiology. Historical accounts sometimes differ on exact dates and attributions, but the broad sequence from tissue extracts to synthetic production is well documented.
| Property | Value | Notes |
|---|---|---|
| Purity (typical) | ≥99% by HPLC | Supplement and pharmacopeial grades vary |
| Water content | ≈12.1% theoretical | Measured by Karl Fischer titration |
| Creatinine limit | Often ≤0.1% in pharmacopeial grade | Supplement specifications may differ |
| Storage conditions | 15–25 °C, low humidity | Away from heat and acidic environments |
| Common analytical methods | HPLC–UV, NMR, FTIR, Karl Fischer | Used for identity, assay, and water content |
Sourcing and verification of creatine monohydrate involve both manufacturing origin and third-party testing. Industrial production commonly starts with sarcosine and cyanamide, followed by crystallization to obtain the monohydrate. Some products are derived from animal sources, while others are synthesized from non-animal precursors. Certificates of analysis report assay, heavy metals, and microbial limits. Regulations differ by country: in the United States it is sold as a dietary supplement, whereas in the European Union it falls under food supplement rules.
In solid form, creatine monohydrate is relatively stable when kept dry and away from heat. Moisture and elevated temperatures promote cyclization into creatinine, a related compound with no role in the phosphagen system. Degradation accelerates in aqueous solution, where the conversion can occur within hours to days depending on pH and temperature. Manufacturers typically recommend storage in sealed containers at room temperature, with relative humidity below 50 percent. Long-term stability data for opened containers are limited.
Commercial creatine monohydrate is typically a white to off-white powder with low odor. It is commonly sold as a fine powder, micronized powder, or larger crystals, but these are physical forms of the same chemical. Purity grades vary, and products may contain small amounts of related substances such as creatinine, dicyandiamide, or moisture. The monohydrate is often selected for supplements and research because its production is well established and its behavior in water is predictable. Analytical certificates usually report assay, loss on drying, and heavy metals.
Creatine monohydrate is a crystalline compound formed from creatine and one water molecule in its solid lattice. Creatine itself is a nitrogen-containing organic acid involved in energy transfer in muscle and other tissues. The monohydrate form is the most common solid form used in research and commercial products because it is stable and easy to handle. The term "monohydrate" refers to the fixed one-to-one ratio of water to creatine in the crystal, not to moisture content. This distinction matters when comparing labels or calculating creatine content.
In chemical terms, creatine monohydrate is often described as N-(aminoiminomethyl)-N-methylglycine monohydrate, though nomenclature varies. Its solid state consists of zwitterionic creatine molecules linked with water through hydrogen bonding. The compound dissolves in water, but dissolution rate depends on particle size, temperature, and agitation. Once dissolved, the hydrate water becomes part of the solvent, leaving free creatine in solution. The monohydrate is not the same as creatine anhydrous, which lacks the water of crystallization and has a higher creatine fraction by mass.
Handling practices aim to limit moisture uptake and thermal exposure. Containers should stay closed when not in use, and storage areas should avoid direct sunlight, strong heat, and high humidity. Caking can occur when powder absorbs water, even if the creatine itself has not fully degraded. Aqueous stock solutions are best prepared fresh when needed because they are less stable than the solid. Open questions include how different excipients, packaging materials, and climate conditions affect long-term stability across global supply chains.
Solid creatine monohydrate is relatively stable when kept dry and sealed, but heat and moisture accelerate its conversion to creatinine. This degradation involves intramolecular cyclization, a process that removes water and forms a less useful compound for phosphocreatine metabolism. Powder stored under cool, dry conditions can remain within specification for extended periods, though exact shelf life depends on packaging, humidity, and initial purity. Aqueous solutions degrade faster than dry powder, with pH and temperature influencing the rate. Because degradation is gradual, analytical testing is used to confirm potency at manufacture and during stability studies.
Quality control for creatine monohydrate typically combines identity, assay, and impurity tests. High-performance liquid chromatography with ultraviolet detection is common for separating creatine from creatinine and related substances. Nuclear magnetic resonance and infrared spectroscopy can confirm molecular structure, while titration may assess acid-base content. Moisture content, heavy metals, residual solvents, and microbial limits are checked according to applicable standards. These tests help distinguish compliant material from powders that have degraded, been diluted, or contain manufacturing residues.
The cloning process can take up to 24 hours and creates larvae that are 2/3 their original length which can help conceal them from the predator. The larvae of these sand dollars clone themselves when they sense dissolved mucus from a predatory fish. The larvae exposed to this mucus from the predatory fish respond to the threat by cloning themselves. This process doubles their population and halves their size which allows them to better escape detection by the predatory fish but may make them more vulnerable to attacks from smaller predators like crustaceans. Sand dollars will also clone themselves during normal asexual reproduction. Larvae will undergo this process when food is plentiful or temperature conditions are optimal. Cloning may also occur to make use of the tissues that are normally lost during metamorphosis. The flattened test of the sand dollar allows it to burrow into the sand and remain hidden from sight from potential predators. Predators of the sand dollar are the fish species cod, flounder, sheepshead and haddock. These fish will prey on sand dollars even through their tough exterior. Sand dollars have spines on their bodies that help them to move around the ocean floor. When a sand dollar dies, it loses the spines and becomes smooth as the endoskeleton is then exposed. During the month of August, the sand dollar will have had its highest gonad index, and in November and December is the time when sand dollars will spawn. Broadcast spawning is how sand dollars reproduce.
=== Aerobic and anaerobic muscle activity === At rest, the body produces the majority of its ATP aerobically in the mitochondria without producing lactic acid or other fatiguing byproducts. During exercise, the method of ATP production varies depending on the fitness of the individual as well as the duration and intensity of exercise. At lower activity levels, when exercise continues for a long duration (several minutes or longer), energy is produced aerobically by combining oxygen with carbohydrates and fats stored in the body. During activity that is higher in intensity, with possible duration decreasing as intensity increases, ATP production can switch to anaerobic pathways, such as the use of the creatine phosphate and the phosphagen system or anaerobic glycolysis. Aerobic ATP production is biochemically much slower and can only be used for long-duration, low-intensity exercise, but produces no fatiguing waste products that cannot be removed immediately from the sarcomere and the body, and it results in a much greater number of ATP molecules per fat or carbohydrate molecule. Aerobic training allows the oxygen delivery system to be more efficient, allowing aerobic metabolism to begin quicker. Anaerobic ATP production produces ATP much faster and allows near-maximal intensity exercise, but also produces significant amounts of lactic acid which render high-intensity exercise unsustainable for more than several minutes. The phosphagen system is also anaerobic.
The Southwest United States is a significant source of turquoise; Arizona, California (San Bernardino, Imperial, Inyo counties), Colorado (Conejos, El Paso, Lake, Saguache counties), New Mexico (Eddy, Grant, Otero, Santa Fe counties) and Nevada (Clark, Elko, Esmeralda County, Eureka, Lander, Mineral County and Nye counties) are (or were) especially rich. The deposits of California and New Mexico were mined by pre-Columbian Native Americans using stone tools, some local and some from as far away as central Mexico. Cerrillos, New Mexico, is thought to be the location of the oldest mines; prior to the 1920s, the state was the country's largest producer; it is more or less exhausted today. Only one mine in California, located at Apache Canyon, operates at a commercial capacity today. The turquoise occurs as vein or seam fillings, and as compact nuggets; these are mostly small in size. While quite fine material is sometimes found, rivalling Iranian material in both colour and durability, most American turquoise is of a low grade (called "chalk turquoise"); high iron levels mean greens and yellows predominate, and a typically friable consistency in the turquoise's untreated state precludes use in jewelry. Arizona is currently the most important producer of turquoise by value. Several mines exist in the state, two of them famous for their unique colour and quality and considered the best in the industry: the Sleeping Beauty Mine in Globe ceased turquoise mining in August 2012.
== Clinical significance == G6PD is remarkable for its genetic diversity. Many variants of G6PD, mostly produced from missense mutations, have been described with wide-ranging levels of enzyme activity and associated clinical symptoms. Two transcript variants encoding different isoforms have been found for this gene. Glucose-6-phosphate dehydrogenase deficiency is very common worldwide, and causes acute hemolytic anemia in the presence of simple infection, ingestion of fava beans, or reaction with certain medicines, antibiotics, antipyretics, and antimalarials.
Coach struggles with alcoholism, but recognizes Demon's potential as a football player. He starts training him as a tight end and he eventually becomes a star player for the Generals. Demon and Maggot drift apart as Maggot takes on a Goth lifestyle and is bullied for his perceived homosexuality. Demon connects with his English teacher Lewis Armstrong. Mr. Armstrong, who is Black, emphasizes the working class population in Virginia who fought on the Union side in the American Civil War. His white wife, Annie, also a teacher, tries to nurture Demon's artistic abilities when he is identified as gifted. Demon takes a job at a farm supply store where he meets and falls in love with Dori, the daughter of the store's owner. Dori, whose mother is dead, shares that she dropped out of school to take care of her dying father. At a football game, Demon gets tackled and badly injures his knee. The team doctor puts him on oxyContin and Demon quickly gets addicted despite warnings from June. After a school dance, Dori gives Demon fentanyl that she stole from her father as they have sex. The two begin a relationship and start regularly abusing substances together. June throws a Fourth of July party at her house. Demon discovers that Hammer Kelly, a Peggot cousin through marriage, has started dating Emmy. Demon introduces Emmy to Fast Forward at the party and they later form a relationship, devastating Kelly.
Sources: en.wikipedia.org
== G == GC-MS – Gas chromatography-mass spectrometry GDMS – Glow discharge mass spectrometry GDOS – Glow discharge optical spectroscopy GISAXS – Grazing incidence small angle X-ray scattering GIXD – Grazing incidence X-ray diffraction GIXR – Grazing incidence X-ray reflectivity GLC – Gas-liquid chromatography GPC – Gel permeation chromatography
=== Primary packaging === Primary packaging is directly in contact with the food products, creating the ideal headspace for them, while providing protection from external alteration. Additionally, primary packaging, also known as retail packaging or consumer units, is responsible for the marketing aspects of food packaging. Typically, the packaging materials used in the primary level include cardboard cartons, plastic trays, glass bottles and multi-layered structures (Tetra Pak).
India is a worldwide centre for information technology and business services, which add 7.5% to GDP and over 35% to services sold abroad. This sector is sustained by a large English-speaking skilled labour force, with revenues surpassing $300 billion in Fiscal Year 2026. Although the industry once relied on basic call centres and simple software fixes, it has shifted toward cloud computing, artificial intelligence, and international tech hubs. Bangalore has grown from a cheap offshore site into a top centre for corporate research, making it one of the largest technology hubs outside Silicon Valley. India's automotive sector comprises 7.1% of its economy. It produces 28 million vehicles every year of which the vast majority are two-wheelers (77%) followed by passenger cars (18%). In 2022, 8 per cent of Indian households owned a car, 55 per cent owned a bicycle, and 54 per cent a motor cycle or scooter. In 2023, India became the third-largest automobile market in the world, with buyers, many of whom are in their 30s, increasingly preferring SUVs. India's pharmaceutical sector relies on a vast network of production facilities focused on low-cost manufacturing. Thousands of individual factories and domestic firms comprise this sector and together make India the main worldwide source of generic medications and vaccines by volume. However, the sector faces supply line vulnerabilities, especially a reliance on China for over 70% of its raw active pharmaceutical ingredients (APIs).
===== Lung ===== In 2019, a method for printing alveoli was developed in which 2D slices of photosensitive hydrogel are successively cured to form a 3D structure of the alveoli. This produces a soft material that is able to easily expand and contract, while also maintaining biocompatibility. The level of curing for the hydrogel is controlled using additive food coloring which absorbs light and increases the curing at that location. This allows the curing to be directed to better form 3D shapes. This method was able to form functional and vascularized alveoli. In 2021, this technique was improved by using an inkjet printing method, which increased the accuracy and precision of alveolar structure. With this ink-jet method, researchers were able to create functional portions of alveolar tissue with increased stability and surfactant secretion.
== Statistics == From 1992 to 2009, Memphis International was the world's busiest airport for cargo operations. It dropped to second place in 2010, just behind Hong Kong. It still remained the busiest cargo airport in the United States and the Western Hemisphere. It briefly rose to first place once again in 2020, due to the surge in e-commerce partly caused by the COVID-19 pandemic, but dropped back to second place in 2021.
Sources: en.wikipedia.org
Among other receptors represented by gangliosides GT1b is highly expressed on the outer membranes of brain metastases cells that originate from an extremely broad range of cancer, while GD1a, GT1b and GQ1b can be detected in human gliosarcomas. However, their quantity is not exceeding the quantity in normal frontal cerebral cortex. The asialoglycoprotein receptors that bind Sendai virus. and serve as SeV cell entry receptors are highly expressed in liver cancers.
Body pain, arthralgia, myalgia Chronic fatigue and insomnia Depression, anxiety and mood disorders Gastrointestinal complications such as constipation, diarrhea, and acid reflux Weight gain or loss Frequent infections
Nicotinamide adenine dinucleotide kinase 2, mitochondrial (NADK2), is a mitochondrial enzyme encoded by the human NADK2 gene. In eukaryotes it maintains the mitochondrial NADP(H) pool by phosphorylating NAD+ and NADH. NADPH plays a central role in mitochondrial metabolism by providing reducing power for protection against oxidative stress and for mitochondrial fatty acid synthesis (mtFAS), proline biosynthesis, lysine degradation, and the beta oxidation of polyunsaturated fatty acids. NADK2 was identified in humans by Ohashi et al. in 2012, more than a decade after its cytosolic counterpart, NADK1. Mutations in the NADK2 gene cause an autosomal recessive disorder known as NADK2 deficiency.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP.
=== Structural convergence === Here is a list of examples in which unrelated proteins have similar tertiary structures but different functions. Whole protein structural convergence is not thought to occur but some convergence of pockets and secondary structural elements have been documented.
Sources: en.wikipedia.org
A sealed container kept at room temperature and away from moisture is typical. Heat and humidity promote conversion to creatinine and can reduce assay values. Long-term storage under dry conditions helps maintain the original crystalline form.
Creatinine is a degradation product formed when creatine loses water and cyclizes. It can appear during storage, processing, or analysis if conditions are harsh. Quality specifications often set a maximum limit for creatinine to control purity.
No universal testing protocol applies across all markets. Some products follow pharmacopeial monographs, while others rely on manufacturer specifications and third-party certificates. Common tests include assay, water content, heavy metals, and microbial limits.
It is a crystalline form of creatine that contains one water molecule per creatine molecule. The compound occurs naturally in muscle tissue and is also produced synthetically for research and consumer products. The monohydrate label describes the solid's hydration state.